PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01003169G0070
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family HSF
Protein Properties Length: 283aa    MW: 29953.2 Da    PI: 4.9025
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01003169G0070genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind80.92e-252886260
                     HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS
     HSF_DNA-bind  2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60
                     Fl+k+y+++++++++++isw+e+g++fvv+ + efa+++LpkyFkh+nf+SFvRQLn+Y
  PH01003169G0070 28 FLTKTYQLVDEPAVDDVISWNEDGSTFVVWRPAEFARDLLPKYFKHNNFSSFVRQLNTY 86
                     9*********************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.102.7E-271886IPR011991Winged helix-turn-helix DNA-binding domain
SMARTSM004156.9E-3024129IPR000232Heat shock factor (HSF)-type, DNA-binding
SuperFamilySSF467855.8E-232587IPR011991Winged helix-turn-helix DNA-binding domain
PfamPF004471.8E-212886IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000564.5E-152851IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000564.5E-156678IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000564.5E-157991IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MAEQGAAADE TAPASAAQAG QRSVPTPFLT KTYQLVDEPA VDDVISWNED GSTFVVWRPA  60
EFARDLLPKY FKHNNFSSFV RQLNTYPPAP SGSGSGSGGV ASGDLGEENE RLRRENARLA  120
RELGQMKRLC NNILLLMSKY AATQQLDAAN AAAAGNCSGE SAEAALPLPP PAVLELMPSC  180
PGAPAAVKAA VAGAEYDEKT GARLFGVSIG GKRMRHDDCG NGGVDPGVKP EPTEADTQPD  240
PKDHTTEPQV WPIYRPRPVY HPLRACNGSD RPGSDHDGSN SW*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5d5u_B3e-1713861587Heat shock factor protein 1
5d5v_B3e-1713861587Heat shock factor protein 1
5d5v_D3e-1713861587Heat shock factor protein 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0056812e-71AP005681.3 Oryza sativa Japonica Group genomic DNA, chromosome 9, BAC clone:OJ1439_F07.
GenBankAP0149652e-71AP014965.1 Oryza sativa Japonica Group DNA, chromosome 9, cultivar: Nipponbare, complete sequence.
GenBankCP0126172e-71CP012617.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 9 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008677301.12e-69PREDICTED: heat shock factor protein 7 isoform X1
SwissprotQ6Z9C85e-63HFB2B_ORYSJ; Heat stress transcription factor B-2b
TrEMBLA0A0D3H2V11e-108A0A0D3H2V1_9ORYZ; Uncharacterized protein
STRINGGRMZM2G098696_P027e-69(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP12137394
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G11660.13e-37HSF family protein